PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G284700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 455aa    MW: 51607.2 Da    PI: 9.0528
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G284700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.83.2e-20189235148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        +g+WT eEd +lv++v+++G ++W++++++mg gR +kqc++rw ++l
  Aqcoe3G284700.1.p 189 KGNWTHEEDRKLVKLVEMHGEKNWAKVSSCMG-GRIGKQCRDRWKNHL 235
                        79******************************.*************97 PP

2Myb_DNA-binding57.53.1e-18281325147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +g WT++Ed  lv+++k++ +g W++Ia++++ gRt++ +k+rw+++
  Aqcoe3G284700.1.p 281 KGCWTEDEDMALVEGHKKHNNG-WAKIAEEIP-GRTDNAVKNRWNSV 325
                        799*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.693184239IPR017930Myb domain
SuperFamilySSF466899.54E-28187236IPR009057Homeodomain-like
SMARTSM007176.2E-19188237IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-21189237IPR009057Homeodomain-like
PfamPF002496.4E-19189235IPR001005SANT/Myb domain
CDDcd001677.61E-17191235No hitNo description
PROSITE profilePS5129421.46276330IPR017930Myb domain
SuperFamilySSF466899.54E-28280322IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-17280328IPR009057Homeodomain-like
SMARTSM007178.8E-17280328IPR001005SANT/Myb domain
PfamPF002497.8E-17281325IPR001005SANT/Myb domain
CDDcd001672.21E-13284326No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MAYQNMYTNE VFYQPTLSLR RPMNRIRPIV GSEFSFDEVK SSQGGLSQDF RYVNQYHSNG  60
KISKSDYYIS ILSFVRLNIF VYGNSNRNLV GSMSVVRKGD TNEIQYENYS DSLRSFENKA  120
TTQDQNQMFL DSPKNDVHAH VETCFGFSNM FPCVTTDNQF VGEVSQIKKS GTHKRKNNEA  180
LKESFSSIKG NWTHEEDRKL VKLVEMHGEK NWAKVSSCMG GRIGKQCRDR WKNHLEPGIN  240
KAQGGARRKV SALPRRYVYK ACAFYIFCAL ASRREALVQK KGCWTEDEDM ALVEGHKKHN  300
NGWAKIAEEI PGRTDNAVKN RWNSVKRRQS SKEKKYRHSK NSLPSPILQE YINNISNKST  360
GSTNKVGNAA TSDCYIPMVD TLAIPIPPAD QGGEAVALPS LPFNFDVSIF EEEMFSILNE  420
GITDNVVPSD VDHLNPYSVN KEMDLFKMIS EANI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C3e-291883293104C-Myb DNA-Binding Domain
1mse_C3e-291883293104C-Myb DNA-Binding Domain
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.16e-38myb domain protein 119